Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2C Rabbit Polyclonal Antibody (HRP)

UBE2C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBCH10, dJ447F3.2

UniProt

O00762

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBE2C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAFPESDNLFKWVGTIHGAAGTAVGSIRTSSTVCLLSGPRETQDSSKPLV

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_861515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MCM3 Antibody (MCM3/3221) [Alexa Fluor 532]
NBP3-24055AF532 0.1 mL

Mouse Monoclonal MCM3 Antibody (MCM3/3221) [Alexa Fluor 532]

Sign In for Pricing
View Details
pExpress-1-Dgcr2 Plasmid
PVT52381 2 µg

pExpress-1-Dgcr2 Plasmid

Sign In for Pricing
View Details
Klra5 (NM_198746) Rat Tagged ORF Clone Lentiviral Particle
RR201598L3V 200 µL

Klra5 (NM_198746) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pl
MBS650678-01 0.005 mg

Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pl

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pl
MBS650678-02 0.02 mg

Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pl

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pl
MBS650678-03 5x 0.02 mg

Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pl

Sign In for Pricing
View Details