Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2E1 Rabbit Polyclonal Antibody (HRP)

UBE2E1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBCH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_872607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (MaxLight 750)
MBS6234157-01 0.1 mL

NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (MaxLight 750)

Sign In for Pricing
View Details
NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (MaxLight 750)
MBS6234157-02 5x 0.1 mL

NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (MaxLight 750)

Sign In for Pricing
View Details
Mouse CX3CL1/Fractalkine ELISA Kit
orb1086316 96 Tests

Mouse CX3CL1/Fractalkine ELISA Kit

Sign In for Pricing
View Details
Mouse Trim56 Pre-designed siRNA Set A
SI115240A 1 Each

Mouse Trim56 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti SARS-CoV-2 RBD Neutralizing antibody, Human IgA
PTXCOV-A569-01 50 µg

Anti SARS-CoV-2 RBD Neutralizing antibody, Human IgA

Sign In for Pricing
View Details
Anti SARS-CoV-2 RBD Neutralizing antibody, Human IgA
PTXCOV-A569-02 100 µg

Anti SARS-CoV-2 RBD Neutralizing antibody, Human IgA

Sign In for Pricing
View Details