Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF144B Rabbit Polyclonal Antibody (HRP)

RNF144B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIR2, IBRDC2, p53RFP, bA528A10.3

UniProt

Q7Z419

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNF144B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_877434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anthrax toxin receptor like (ANTXRL) ELISA Kit
MBS7223554-01 48 Well

Human Anthrax toxin receptor like (ANTXRL) ELISA Kit

Sign In for Pricing
View Details
Human Anthrax toxin receptor like (ANTXRL) ELISA Kit
MBS7223554-02 96 Well

Human Anthrax toxin receptor like (ANTXRL) ELISA Kit

Sign In for Pricing
View Details
Human Anthrax toxin receptor like (ANTXRL) ELISA Kit
MBS7223554-03 5x 96 Well

Human Anthrax toxin receptor like (ANTXRL) ELISA Kit

Sign In for Pricing
View Details
Human Anthrax toxin receptor like (ANTXRL) ELISA Kit
MBS7223554-04 10x 96 Well

Human Anthrax toxin receptor like (ANTXRL) ELISA Kit

Sign In for Pricing
View Details
FGF1 Rabbit Polyclonal Antibody (AP)
orb970330 100 µL

FGF1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
RUNX2 Rabbit Polyclonal Antibody (HRP)
orb2579684 100 µg

RUNX2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details