Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (Biotin)

TRIM55 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

Q9BYV6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM55

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_908975

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1P23 ORF Vector (Human) (pORF)
ORF018702 1.0 µg DNA

EEF1A1P23 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human CRTC3 sgRNA gene knockout kit - Lentiviral human CRTC3 sgRNA gene knockout kit (plasmid)
GTR15393575 1 Vial

Lentiviral human CRTC3 sgRNA gene knockout kit - Lentiviral human CRTC3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Fetoprotein, alpha (Alpha Fetoglobulin, FETA, HPAFP) (BSA & Azide Free)
172093-AF 100 µg

Fetoprotein, alpha (Alpha Fetoglobulin, FETA, HPAFP) (BSA & Azide Free)

Sign In for Pricing
View Details
Bupivacaine hydrochloride monohydrate
orb1944114-01 1 mg

Bupivacaine hydrochloride monohydrate

Sign In for Pricing
View Details
Bupivacaine hydrochloride monohydrate
orb1944114-02 5 mg

Bupivacaine hydrochloride monohydrate

Sign In for Pricing
View Details
Bupivacaine hydrochloride monohydrate
orb1944114-03 10 mg

Bupivacaine hydrochloride monohydrate

Sign In for Pricing
View Details