Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (Biotin)

TRIM55 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

Q9BYV6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TRI55

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Yeast

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAS antibody
70R-1652 100 ug

GNAS antibody

Sign In for Pricing
View Details
Anti-Calcium Sensing Receptor  (3F12)
YF-MA12270 100 ug

Anti-Calcium Sensing Receptor (3F12)

Sign In for Pricing
View Details
Human Ankyrin repeat and protein kinase domain containing protein 1 (ANKK1) ELISA Kit
GTR10327829 96 Well

Human Ankyrin repeat and protein kinase domain containing protein 1 (ANKK1) ELISA Kit

Sign In for Pricing
View Details
Bovine Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit
MBS9924830-01 48 Well

Bovine Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit

Sign In for Pricing
View Details
Bovine Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit
MBS9924830-02 96 Well

Bovine Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit

Sign In for Pricing
View Details
Bovine Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit
MBS9924830-03 5x 96 Well

Bovine Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit

Sign In for Pricing
View Details