Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (FITC)

TRIM55 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

Q9BYV6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TRI55

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Yeast

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk1, CT (Cdk1, Cdc2, Cdc2a, Cdkn1, Cyclin-dependent kinase 1, Cell division control protein 2 homolog, Cell division protein kinase 1, p34 protein kinase) (MaxLight 405) discontinued
033640-ML405 100 µL

Cdk1, CT (Cdk1, Cdc2, Cdc2a, Cdkn1, Cyclin-dependent kinase 1, Cell division control protein 2 homolog, Cell division protein kinase 1, p34 protein kinase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-03 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-04 0.1 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details