Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (HRP)

TRIM55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

Q9BYV6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TRI55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Yeast

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit
MBS450975-01 48 Tests

Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit
MBS450975-02 96 Tests

Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit
MBS450975-03 5x 96 Tests

Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit
MBS450975-04 10x 96 Tests

Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
MCM6 Rabbit Polyclonal Antibody (BF488)
orb2481934 100 µL

MCM6 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Mouse Monoclonal anti-Human IgD Antibody
xAP-0400 100 µg

Mouse Monoclonal anti-Human IgD Antibody

Sign In for Pricing
View Details