Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM54 Rabbit Polyclonal Antibody (HRP)

TRIM54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MURF, RNF30, muRF3, MURF-3

UniProt

Q9BYV2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Inhba/Inhibin beta A chain ELISA Kit
E45K00340 96 Tests

Mouse Inhba/Inhibin beta A chain ELISA Kit

Sign In for Pricing
View Details
Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (MDX-1105)
E24CHA082 100 µg

Anti-B7-H1 / PD-L1 / CD274 Reference Antibody (MDX-1105)

Sign In for Pricing
View Details
Cym Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
17305064 1.0 µg DNA

Cym Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KCNJ8 Knockout HAP1 Polyclonal Cells
ARG22949 1 Million

KCNJ8 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Prickle (PRICKLE1) (NM_001144882) Human Untagged Clone
SC325349 10 µg

Prickle (PRICKLE1) (NM_001144882) Human Untagged Clone

Sign In for Pricing
View Details
WFDC3 AAV Vector (Rat) (CMV)
50407106 1 µg

WFDC3 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details