Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP3 Rabbit Polyclonal Antibody (Biotin)

STEAP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

STMP3, TSAP6, pHyde, AHMIO2, dudlin-2, dudulin-2

UniProt

A8K6E3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STEAP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human WLS shRNA (UAS) - Lentiviral human WLS shRNA (UAS, iRFP) plasmid
GTR15322663 1 Vial

Lentiviral human WLS shRNA (UAS) - Lentiviral human WLS shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
C6orf123 3'UTR Luciferase Stable Cell Line
TU002409 1.0 mL

C6orf123 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Protein polybromo-1 (PBRM1) Human ELISA Kit
G3970 96 Tests

Protein polybromo-1 (PBRM1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Seizure protein 6 homolog (SEZ6), partial
CSB-EP684467HU4-01 20 µg

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

Sign In for Pricing
View Details
Recombinant Human Seizure protein 6 homolog (SEZ6), partial
CSB-EP684467HU4-02 100 µg

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

Sign In for Pricing
View Details
Recombinant Human Seizure protein 6 homolog (SEZ6), partial
CSB-EP684467HU4-03 1 mg

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

Sign In for Pricing
View Details