Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP3 Rabbit Polyclonal Antibody (HRP)

STEAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

STMP3, TSAP6, pHyde, AHMIO2, dudlin-2, dudulin-2

UniProt

A8K6E3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STEAP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fallopian tube disease spectrum (fallopian tube cancer progression) tissue array, including pathology grade, TNM and clinical stage, 30 cases/60 cores
UTE601 1 Each

Fallopian tube disease spectrum (fallopian tube cancer progression) tissue array, including pathology grade, TNM and clinical stage, 30 cases/60 cores

Sign In for Pricing
View Details
Mmu-miR-145a-3p miRNA Antagomir
orb1913341-01 10 nmol

Mmu-miR-145a-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-145a-3p miRNA Antagomir
orb1913341-02 20 nmol

Mmu-miR-145a-3p miRNA Antagomir

Sign In for Pricing
View Details
GENLISA™ Canine Neutrophil gelatinase-associated lipocalin (NGAL) ELISA
KLN0105 1x 96 Well

GENLISA™ Canine Neutrophil gelatinase-associated lipocalin (NGAL) ELISA

Sign In for Pricing
View Details
Beta Arrestin 2
520577-01 100 µL

Beta Arrestin 2

Sign In for Pricing
View Details
Beta Arrestin 2
520577-02 200 µL

Beta Arrestin 2

Sign In for Pricing
View Details