Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM176A Rabbit Polyclonal Antibody (HRP)

TMEM176A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GS188, MS4B1, HCA112

UniProt

Q96HP8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM176A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_060957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parp12 sgRNA CRISPR Lentivector set (Mouse)
K3626501 3x 1.0 µg

Parp12 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CCDC116 Antibody
orb354275-01 50 µg

CCDC116 Antibody

Sign In for Pricing
View Details
CCDC116 Antibody
orb354275-02 100 µg

CCDC116 Antibody

Sign In for Pricing
View Details
SCG5 3'UTR Luciferase Stable Cell Line
TU022699 1.0 mL

SCG5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse ERN2 Protein, His (Fc)-Avi-tagged
ERN2-2857M 50 µg

Recombinant Mouse ERN2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
DHCR24 (24 dehydrocholesterol Reductase, 24-dehydrocholesterol Reductase, 3 beta hydroxysterol delta 24 Reductase, 3-beta-hydroxysterol delta-24-Reductase, DCE, Delta (24) -sterol Reductase, Desmosterol to cholesterol Enzyme, DHC24_HUMAN, DHCR24, Diminuto dwarf1 Homolog, Diminuto/dwarf1 Homolog, KIAA0018, Nbla03646, Seladin-1, SELADIN1, Selective AD indicator 1, Selective Alzheimer's Disease Indicator 1) discontinued
222153-01 50 µL

DHCR24 (24 dehydrocholesterol Reductase, 24-dehydrocholesterol Reductase, 3 beta hydroxysterol delta 24 Reductase, 3-beta-hydroxysterol delta-24-Reductase, DCE, Delta (24) -sterol Reductase, Desmosterol to cholesterol Enzyme, DHC24_HUMAN, DHCR24, Diminuto dwarf1 Homolog, Diminuto/dwarf1 Homolog, KIAA0018, Nbla03646, Seladin-1, SELADIN1, Selective AD indicator 1, Selective Alzheimer's Disease Indicator 1) discontinued

Sign In for Pricing
View Details