Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECH1 Rabbit Polyclonal Antibody (Biotin)

ECH1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HPXEL

UniProt

Q13011

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ECH1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST1 Protein Vector (Rat) (pPM-C-HA)
PV283448 500 ng

MST1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit
MBS9351117-01 48 Well

Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit
MBS9351117-02 96 Well

Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit
MBS9351117-03 5x 96 Well

Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit
MBS9351117-04 10x 96 Well

Mouse Serine/Arginine-Rich Splicing Factor 5 (SFRS5) ELISA Kit

Sign In for Pricing
View Details
ICAM1/CD54 Mouse Monoclonal Antibody (PE)
orb499243 100 µL

ICAM1/CD54 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details