Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Rabbit Polyclonal Antibody (HRP)

Gnmt Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9QXF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSKFRLSYYPHCLASFTELVRAAFGGRCQHSVLGDFKPYKPGQAYVPCYF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD85j (CD85 antigen-like family member J, Leukocyte immunoglobulin-like receptor subfamily B member 1, Leukocyte immunoglobulin-like receptor 1, LIR-1, Monocyte/macrophage immunoglobulin-like receptor 7, Immunoglobulin-like transcript 2, LILRB1, ILT2, LIR1, MIR7) (MaxLight 490) discontinued
I7502-81B-ML490 100 µL

CD85j (CD85 antigen-like family member J, Leukocyte immunoglobulin-like receptor subfamily B member 1, Leukocyte immunoglobulin-like receptor 1, LIR-1, Monocyte/macrophage immunoglobulin-like receptor 7, Immunoglobulin-like transcript 2, LILRB1, ILT2, LIR1, MIR7) (MaxLight 490) discontinued

Sign In for Pricing
View Details
CLDN18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16272061 1.0 µg DNA

CLDN18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
1- (4-sulfobutyl) -3-methylimidazolium triflate
IL-0353-HP-0500 500 g

1- (4-sulfobutyl) -3-methylimidazolium triflate

Sign In for Pricing
View Details
IGHD3OR15-3B 3'UTR Lenti-reporter-Luc Vector
24359081 1.0 µg

IGHD3OR15-3B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Monoclonal HSP27 Antibody (6H11) [Alexa Fluor 405]
NBP2-25149AF405 0.1 mL

Mouse Monoclonal HSP27 Antibody (6H11) [Alexa Fluor 405]

Sign In for Pricing
View Details
TACI HDR Plasmid (m)
sc-425465-HDR 20 µg

TACI HDR Plasmid (m)

Sign In for Pricing
View Details