Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Rabbit Polyclonal Antibody (HRP)

Gnmt Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9QXF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSKFRLSYYPHCLASFTELVRAAFGGRCQHSVLGDFKPYKPGQAYVPCYF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endocrine system benign, malignant tumor and normal tissue array, including TNM and clinical stage, 104 cases/208 cores
ENS2081 104 Cases / 208 Cores

Endocrine system benign, malignant tumor and normal tissue array, including TNM and clinical stage, 104 cases/208 cores

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit
MBS9346675-01 48 Well

Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit
MBS9346675-02 96 Well

Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit
MBS9346675-03 5x 96 Well

Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit
MBS9346675-04 10x 96 Well

Rat Integral Membrane Protein GPR137B (GPR137B) ELISA Kit

Sign In for Pricing
View Details
CCDC88A Antibody
MBS8590755-01 0.1 mg

CCDC88A Antibody

Sign In for Pricing
View Details