Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH4 Rabbit Polyclonal Antibody (FITC)

ADH4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ADH-2, HEL-S-4

UniProt

P08319

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ADH4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000661

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A7L6) [DyLight 350]
NBP2-47695UV 0.1 mL

Rat Monoclonal Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A7L6) [DyLight 350]

Sign In for Pricing
View Details
Lentiviral mouse Ints7 shRNA (UAS) - Lentiviral mouse Ints7 shRNA (UAS, iRFP) (100)
GTR15174675 1 Vial

Lentiviral mouse Ints7 shRNA (UAS) - Lentiviral mouse Ints7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
HES1 Rabbit Polyclonal Antibody (BF680)
orb1583023 100 µL

HES1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Killer toxin subunit gamma
MBS1026641-01 0.05 mg (E-Coli)

Recombinant Kluyveromyces lactis Killer toxin subunit gamma

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Killer toxin subunit gamma
MBS1026641-02 0.05 mg (Yeast)

Recombinant Kluyveromyces lactis Killer toxin subunit gamma

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Killer toxin subunit gamma
MBS1026641-03 0.2 mg (E-Coli)

Recombinant Kluyveromyces lactis Killer toxin subunit gamma

Sign In for Pricing
View Details