Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCHFR Rabbit Polyclonal Antibody (HRP)

GCHFR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P35, GFRP, HsT16933

UniProt

P30047

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GCHFR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CHK2/CHEK2 Protein (His & GST Tag)
PKSM040303 50 µg

Recombinant Mouse CHK2/CHEK2 Protein (His & GST Tag)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]
AN00334H-01 20 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]
AN00334H-02 100 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]
AN00334H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
SATB1 Human Gene Knockout Kit (CRISPR)
KN200421BN 1 Kit

SATB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Indo-1, Pentasodium Salt
#50042 1x 1 mg

Indo-1, Pentasodium Salt

Sign In for Pricing
View Details