Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cxxc1 Rabbit Polyclonal Antibody (FITC)

Cxxc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A1A5S2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Cxxc1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRERDGSERDGS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Selenoprotein P, SEPP1 ELISA Kit
MBS1609792 96 Well

Bovine Selenoprotein P, SEPP1 ELISA Kit

Sign In for Pricing
View Details
Cyclooxygenase-2, CT (PTGS2, Prostaglandin G/H Synthase 2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, COX2, Prostaglandin-endoperoxide Synthase 2) discontinued
C7904-83P 250 µL

Cyclooxygenase-2, CT (PTGS2, Prostaglandin G/H Synthase 2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, COX2, Prostaglandin-endoperoxide Synthase 2) discontinued

Sign In for Pricing
View Details
IGHVIII-67-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV764657 1.0 µg DNA

IGHVIII-67-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Chromium (III) chloride hexahydrate, Hi-
GRM5743-500G 1 unit

Chromium (III) chloride hexahydrate, Hi-

Sign In for Pricing
View Details
Mepe Mouse shRNA Plasmid (Locus ID 94111)
TR509210 1 Kit

Mepe Mouse shRNA Plasmid (Locus ID 94111)

Sign In for Pricing
View Details
Mouse Rhizopus arrhizu Fatty Acid Desaturases 6 ELISA kit
GTR10458961 96 Well

Mouse Rhizopus arrhizu Fatty Acid Desaturases 6 ELISA kit

Sign In for Pricing
View Details