Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cxxc1 Rabbit Polyclonal Antibody (HRP)

Cxxc1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A1A5S2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Cxxc1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRERDGSERDGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF1 (Golgi Apparatus Marker) (1A9/5), 0.2mg/mL
BNUB2028-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (1A9/5), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS640899 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Renal pelvis
CS702168 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details
GRASP65 (GORASP1) Human Knockdown Lysate
LY300181 100 µg

GRASP65 (GORASP1) Human Knockdown Lysate

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF488A conjugate, 0.1mg/mL
BNC882683-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS700792 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details