Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMF Rabbit Polyclonal Antibody (HRP)

BMF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BMF

UniProt

Q96LC9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BMF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Let-754 Antibody
orb800714 2 mg

Let-754 Antibody

Sign In for Pricing
View Details
ITCH (E3 Ubiquitin-protein Ligase Itchy Homolog, Itch, Atrophin-1-interacting Protein 4, AIP4, NFE2-associated Polypeptide 1, NAPP1, DJ468O1.1) (MaxLight 550)
MBS6212123-01 0.1 mL

ITCH (E3 Ubiquitin-protein Ligase Itchy Homolog, Itch, Atrophin-1-interacting Protein 4, AIP4, NFE2-associated Polypeptide 1, NAPP1, DJ468O1.1) (MaxLight 550)

Sign In for Pricing
View Details
ITCH (E3 Ubiquitin-protein Ligase Itchy Homolog, Itch, Atrophin-1-interacting Protein 4, AIP4, NFE2-associated Polypeptide 1, NAPP1, DJ468O1.1) (MaxLight 550)
MBS6212123-02 5x 0.1 mL

ITCH (E3 Ubiquitin-protein Ligase Itchy Homolog, Itch, Atrophin-1-interacting Protein 4, AIP4, NFE2-associated Polypeptide 1, NAPP1, DJ468O1.1) (MaxLight 550)

Sign In for Pricing
View Details
MBD3 Antibody
AF0353-01 100 µL

MBD3 Antibody

Sign In for Pricing
View Details
MBD3 Antibody
AF0353-02 200 µL

MBD3 Antibody

Sign In for Pricing
View Details
SLC47A1 Protein Vector (Rat) (pPM-C-HA)
PV306208 500 ng

SLC47A1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details