Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC27 Rabbit Polyclonal Antibody (Biotin)

CDC27 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

APC3, HNUC, NUC2, H-NUC, ANAPC3, CDC27Hs, D0S1430E, D17S978E

UniProt

P30260

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDC27

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAF siRNA (Mouse)
MBS8224793-01 15 nmol

OAF siRNA (Mouse)

Sign In for Pricing
View Details
OAF siRNA (Mouse)
MBS8224793-02 30 nmol

OAF siRNA (Mouse)

Sign In for Pricing
View Details
OAF siRNA (Mouse)
MBS8224793-03 5x 30 nmol

OAF siRNA (Mouse)

Sign In for Pricing
View Details
PIP5KL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36717061 1.0 µg DNA

PIP5KL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MRPL14 (39S Ribosomal Protein L14, Mitochondrial, L14mt, MRP-L14, 39S Ribosomal Protein L32, Mitochondrial, L32mt, MRP-L32, MRPL14, MRPL32, RPML32) (HRP) discontinued
302567-HRP 100 µL

MRPL14 (39S Ribosomal Protein L14, Mitochondrial, L14mt, MRP-L14, 39S Ribosomal Protein L32, Mitochondrial, L32mt, MRP-L32, MRPL14, MRPL32, RPML32) (HRP) discontinued

Sign In for Pricing
View Details
Human Mannose Binding Lectin C (MBLC) ELISA Kit
YP-W17944-01 48 Tests

Human Mannose Binding Lectin C (MBLC) ELISA Kit

Sign In for Pricing
View Details