Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr1h2 Rabbit Polyclonal Antibody (HRP)

Nr1h2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LXRB, OR-1, LXRbeta, LXR beta

UniProt

Q8BP65

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Nr1h2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_113814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmocollin-2/3 (rDSC2/3437), CF740 conjugate, 0.1mg/mL
BNC743437-100 1x 100 µL

Desmocollin-2/3 (rDSC2/3437), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LMAN2/VIP36 Protein (E.coli, His Tag)
PKSH030834 100 µg

Recombinant Human LMAN2/VIP36 Protein (E.coli, His Tag)

Sign In for Pricing
View Details
CD74 (B-Cell Marker) (CLIP/3127R), CF568 conjugate, 0.1mg/mL
BNC683127-100 1x 100 µL

CD74 (B-Cell Marker) (CLIP/3127R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1700028P14Rik Mouse Gene Knockout Kit (CRISPR)
KN500125 1 Kit

1700028P14Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KRTAP10-7 activation kit by CRISPRa
GA117860 1 Kit

Human KRTAP10-7 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS800360 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details