Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr1h2 Rabbit Polyclonal Antibody (HRP)

Nr1h2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LXRB, OR-1, LXRbeta, LXR beta

UniProt

Q8BP65

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Nr1h2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_113814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]
TA507376AM 100 µL

ZFAND3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]

Sign In for Pricing
View Details
PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]
CF807333 100 µg

PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]

Sign In for Pricing
View Details
UBE2I antibody
FNab09158 100 µg

UBE2I antibody

Sign In for Pricing
View Details
5-Amino-1-naphthalenesulfonamide Hydrochloride
TRC-A618350-250MG 250 mg

5-Amino-1-naphthalenesulfonamide Hydrochloride

Sign In for Pricing
View Details
Human ARL2 activation kit by CRISPRa
GA100292 1 Kit

Human ARL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Diclofenac Amide
TRC-D436440-250MG 250 mg

Diclofenac Amide

Sign In for Pricing
View Details