Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcc2 Rabbit Polyclonal Antibody (HRP)

Abcc2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mr, Cmo, Mrp2, cMRP, Abc30, Cmoat, AI173996

UniProt

Q8VI47

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

174kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD9P1 ORF Vector (Human) (pORF)
ORF022165 1.0 µg DNA

KCTD9P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CPM (Carboxypeptidase M, CBPM, CPM, Renal carboxypeptidase, Urinary carboxypeptidase B) discontinued
221856-01 50 µL

CPM (Carboxypeptidase M, CBPM, CPM, Renal carboxypeptidase, Urinary carboxypeptidase B) discontinued

Sign In for Pricing
View Details
CPM (Carboxypeptidase M, CBPM, CPM, Renal carboxypeptidase, Urinary carboxypeptidase B) discontinued
221856-02 100 µL

CPM (Carboxypeptidase M, CBPM, CPM, Renal carboxypeptidase, Urinary carboxypeptidase B) discontinued

Sign In for Pricing
View Details
RRAS (NM_006270) Human Over-expression Lysate
LS006237 100 µg

RRAS (NM_006270) Human Over-expression Lysate

Sign In for Pricing
View Details
InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)
MBS1570034-01 0.1 mg

InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)

Sign In for Pricing
View Details
InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)
MBS1570034-02 1 mg

InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)

Sign In for Pricing
View Details