Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcf1 Rabbit Polyclonal Antibody (HRP)

Abcf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Abc50

UniProt

Q6MG08

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IP, WB

NCBI Accession Number

NP_001103353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (PE)
MBS6159108-01 0.1 mL

NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (PE)

Sign In for Pricing
View Details
NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (PE)
MBS6159108-02 5x 0.1 mL

NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (PE)

Sign In for Pricing
View Details
SMOC2 protein, Human, Recombinant (His)
E51P91695 20 µg

SMOC2 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Lentiviral mouse Sbp shRNA (UAS) - Lentiviral mouse Sbp shRNA (UAS) plasmid
GTR15226951 1 Vial

Lentiviral mouse Sbp shRNA (UAS) - Lentiviral mouse Sbp shRNA (UAS) plasmid

Sign In for Pricing
View Details
XRCC1 (X-ray Repair Cross-complementing Protein 1, DNA Repair Protein XRCC1, RCC) (HRP)
MBS6398770-01 0.1 mL

XRCC1 (X-ray Repair Cross-complementing Protein 1, DNA Repair Protein XRCC1, RCC) (HRP)

Sign In for Pricing
View Details
XRCC1 (X-ray Repair Cross-complementing Protein 1, DNA Repair Protein XRCC1, RCC) (HRP)
MBS6398770-02 5x 0.1 mL

XRCC1 (X-ray Repair Cross-complementing Protein 1, DNA Repair Protein XRCC1, RCC) (HRP)

Sign In for Pricing
View Details