Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG2 Rabbit Polyclonal Antibody (FITC)

DLG2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PSD93, PSD-93, PPP1R58, chapsyn-110

UniProt

Q15700

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLG2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEAN1 Human Gene Knockout Kit (CRISPR)
KN427848 1 Kit

BEAN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HRP Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-
H-1701-1 1 mg

HRP Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-

Sign In for Pricing
View Details
Bulleyaconitine A
TRC-B689710-10MG 10 mg

Bulleyaconitine A

Sign In for Pricing
View Details
Anti-Mouse IFN Alpha (TIF-3C5) In Vivo Antibody - Low Endotoxin
ICH1135-25mg 25 mg

Anti-Mouse IFN Alpha (TIF-3C5) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Castor Oil, Technical Grade
TRC-C184805-25ML 25 mL

Castor Oil, Technical Grade

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG
HAF-011-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG

Sign In for Pricing
View Details