Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17F, Mouse (HEK293, His)

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][2]. IL-17F Protein, Mouse (HEK293, His) is a recombinant mouse IL-17F protein with His tag at the C-terminus and is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

IL-17F Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17f-protein-mouse-133a-a-hek293-his.html

Purity

98.0

Smiles

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Molecular Formula

257630 (Gene_ID) Q7TNI7-1 (R29-A161) (Accession)

Molecular Weight

Approximately 17-23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chang SH, et al. IL-17F: regulation, signaling and function in inflammation. Cytokine. 2009 Apr;46 (1) :7-11.|[2]McGeachy MJ, et al. The IL-17 Family of Cytokines in Health and Disease. Immunity. 2019 Apr 16;50 (4) :892-906.|[3]Ferreira N, et al. IL-17A and IL-17F orchestrate macrophages to promote lung cancer. Cell Oncol (Dordr) . 2020 Aug;43 (4) :643-654.|[4]Tong Z, et al. A protective role by interleukin-17F in colon tumorigenesis. PLoS One. 2012;7 (4) :e34959.|[5]Yang XO, et al. Regulation of inflammatory responses by IL-17F. J Exp Med. 2008 May 12;205 (5) :1063-75.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC22A17 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43943156 3x 1.0 µg DNA

SLC22A17 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details
Lentiviral mouse Pnoc shRNA (UAS) - Lentiviral mouse Pnoc shRNA (UAS) (100)
GTR15210186 1 Vial

Lentiviral mouse Pnoc shRNA (UAS) - Lentiviral mouse Pnoc shRNA (UAS) (100)

Ask
View Details
Megovalicin A
MF-0124532-01 10 mg

Megovalicin A

Ask
View Details
Megovalicin A
MF-0124532-02 50 mg

Megovalicin A

Ask
View Details
RGD1312026 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
39166156 3x 1.0 µg DNA

RGD1312026 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details
Recombinant Human Transmembrane protein 40 (TMEM40)
MBS7031853-01 0.02 mg

Recombinant Human Transmembrane protein 40 (TMEM40)

Ask
View Details