Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG2 Rabbit Polyclonal Antibody (HRP)

DLG2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSD93, PSD-93, PPP1R58, chapsyn-110

UniProt

Q15700

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLG2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse INa (Internexin Neuronal Intermediate Filament Protein Alpha) Microsample ELISA Kit
orb2997586-01 48 Tests

Mouse INa (Internexin Neuronal Intermediate Filament Protein Alpha) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse INa (Internexin Neuronal Intermediate Filament Protein Alpha) Microsample ELISA Kit
orb2997586-02 96 Tests

Mouse INa (Internexin Neuronal Intermediate Filament Protein Alpha) Microsample ELISA Kit

Sign In for Pricing
View Details
TNIP1 Rabbit Polyclonal Antibody (BF680)
orb2375101 100 µL

TNIP1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Rabbit Anti SMARCD1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200ul
IRBAMLSMARCD1AP982200UL 200 µL

Rabbit Anti SMARCD1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200ul

Sign In for Pricing
View Details
MUTYH (A/G-specific Adenine DNA Glycosylase, MutY Homolog, hMYH, MYH) (MaxLight 750)
MBS6386180-01 0.1 mL

MUTYH (A/G-specific Adenine DNA Glycosylase, MutY Homolog, hMYH, MYH) (MaxLight 750)

Sign In for Pricing
View Details
MUTYH (A/G-specific Adenine DNA Glycosylase, MutY Homolog, hMYH, MYH) (MaxLight 750)
MBS6386180-02 5x 0.1 mL

MUTYH (A/G-specific Adenine DNA Glycosylase, MutY Homolog, hMYH, MYH) (MaxLight 750)

Sign In for Pricing
View Details