Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC3 Rabbit Polyclonal Antibody (FITC)

ABCC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MLP2, MRP3, ABC31, MOAT-D, cMOAT2, EST90757

UniProt

O15438

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABCC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXXC-type zinc finger protein 4, CXXC4 ELISA KIT
ELI-46800h 96 Tests

Human CXXC-type zinc finger protein 4, CXXC4 ELISA KIT

Sign In for Pricing
View Details
Human ITGA4 Protein
orb1477814-01 20 µg

Human ITGA4 Protein

Sign In for Pricing
View Details
Human ITGA4 Protein
orb1477814-02 100 µg

Human ITGA4 Protein

Sign In for Pricing
View Details
Human ITGA4 Protein
orb1477814-03 1 mg

Human ITGA4 Protein

Sign In for Pricing
View Details
Lentiviral mouse Mrc2 shRNA (UAS) - Lentiviral mouse Mrc2 shRNA (UAS) (100)
GTR15129690 1 Vial

Lentiviral mouse Mrc2 shRNA (UAS) - Lentiviral mouse Mrc2 shRNA (UAS) (100)

Sign In for Pricing
View Details
RTN4RL1, CT (RTN4RL1, NGRH2, NGRL2, Reticulon-4 receptor-like 1, Nogo receptor-like 2, Nogo-66 receptor homolog 2, Nogo-66 receptor-related protein 3) (Biotin)
MBS6344372-01 0.2 mL

RTN4RL1, CT (RTN4RL1, NGRH2, NGRL2, Reticulon-4 receptor-like 1, Nogo receptor-like 2, Nogo-66 receptor homolog 2, Nogo-66 receptor-related protein 3) (Biotin)

Sign In for Pricing
View Details