Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCD4 Rabbit Polyclonal Antibody (FITC)

ABCD4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P70R, P79R, ABC41, MAHCJ, PMP69, PXMP1L, EST352188

UniProt

O14678

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCD4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005041

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF789 sgRNA CRISPR Lentivector (Human) (Target 1)
K2733702 1.0 µg DNA

ZNF789 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PKIB Antibody, HRP conjugated
A70094-50UG 50 µg

PKIB Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Placenta Cadherin (P-cad) ELISA Kit
RK07508 96 Tests

Human Placenta Cadherin (P-cad) ELISA Kit

Sign In for Pricing
View Details
TMS1 Conjugated Antibody
orb1611875 100 µL

TMS1 Conjugated Antibody

Sign In for Pricing
View Details
SPRY2 (SPRY2, HSPRY2, Protein Sprouty Homolog 2, Sprouty Homolog 2 (Drosophila), Sprouty 2, Spry-2, Sprouty (Drosophila) Homolog 2) discontinued. see S5620-02
215826 50 µg

SPRY2 (SPRY2, HSPRY2, Protein Sprouty Homolog 2, Sprouty Homolog 2 (Drosophila), Sprouty 2, Spry-2, Sprouty (Drosophila) Homolog 2) discontinued. see S5620-02

Sign In for Pricing
View Details
LIN7C Rabbit Polyclonal Antibody (FITC)
orb2121513 100 µL

LIN7C Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details