Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abca1 Rabbit Polyclonal Antibody (HRP)

Abca1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ABC, Abc1, ABC-1

UniProt

B1AWZ8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

254kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody (15E5) [HRP]
NBP2-22557H 0.1 mL

Mouse Monoclonal Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody (15E5) [HRP]

Sign In for Pricing
View Details
MMP-2 Inhibitor Screening Kit (Fluorometric)
K2017-100 100 Assays

MMP-2 Inhibitor Screening Kit (Fluorometric)

Sign In for Pricing
View Details
Rno-miR-212-5p inhibitor
HY-RI04302-01 5 nmol

Rno-miR-212-5p inhibitor

Sign In for Pricing
View Details
Rno-miR-212-5p inhibitor
HY-RI04302-02 20 nmol

Rno-miR-212-5p inhibitor

Sign In for Pricing
View Details
Anti-Cystatin A Antibody, Rabbit Polyclonal
MBS8102950-01 0.1 mL

Anti-Cystatin A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cystatin A Antibody, Rabbit Polyclonal
MBS8102950-02 5x 0.1 mL

Anti-Cystatin A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details