Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCF2 Rabbit Polyclonal Antibody (HRP)

ABCF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ABC28, HUSSY18, HUSSY-18, EST133090

UniProt

Q75MJ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABCF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005683

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIB Protein Vector (Rat) (pPM-C-HA)
37356026 500 ng

PPIB Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CD307 Polyclonal Antibody
RA23025-01 50 µL

CD307 Polyclonal Antibody

Sign In for Pricing
View Details
CD307 Polyclonal Antibody
RA23025-02 100 µL

CD307 Polyclonal Antibody

Sign In for Pricing
View Details
TTLL13 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
48726156 3x 1.0 µg DNA

TTLL13 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
BC057552 (BC057552) Mouse Tagged ORF Clone
MR209302 10 µg

BC057552 (BC057552) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human CD295 Protein
MBS8304924-01 0.01 mg

Recombinant Human CD295 Protein

Sign In for Pricing
View Details