Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD50 Rabbit Polyclonal Antibody (Biotin)

RAD50 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NBSLD, RAD502, hRad50

UniProt

Q92878

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD50

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit
MBS9941851-01 48 Well

Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit

Sign In for Pricing
View Details
Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit
MBS9941851-02 96 Well

Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit

Sign In for Pricing
View Details
Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit
MBS9941851-03 5x 96 Well

Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit

Sign In for Pricing
View Details
Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit
MBS9941851-04 10x 96 Well

Horse Sperm Acrosome-Associated Protein 5 (SPACA5) ELISA Kit

Sign In for Pricing
View Details
Annexin II-PE discontinued
A2295-23-PE 100 µL

Annexin II-PE discontinued

Sign In for Pricing
View Details
FOXD1 discontinued
389231 200 µL

FOXD1 discontinued

Sign In for Pricing
View Details