Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP46A1 Rabbit Polyclonal Antibody (HRP)

CYP46A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CP46, CYP46

UniProt

Q9Y6A2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP46A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006659

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine CRP ELISA Kit
orb438867-01 48 Tests

Porcine CRP ELISA Kit

Sign In for Pricing
View Details
Porcine CRP ELISA Kit
orb438867-02 96 Tests

Porcine CRP ELISA Kit

Sign In for Pricing
View Details
Human INPP5E Pre-designed siRNA Set B
SI007686B 1 Each

Human INPP5E Pre-designed siRNA Set B

Sign In for Pricing
View Details
Duck Crystallin Zeta (CRYZ) ELISA Kit
MBS9918280 Inquire

Duck Crystallin Zeta (CRYZ) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit
MBS9346907-01 48 Well

Mouse Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit
MBS9346907-02 96 Well

Mouse Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details