Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcb10 Rabbit Polyclonal Antibody (FITC)

Abcb10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ABC-m, Abc-me, Abcb12

UniProt

Q9JI39

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062425

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1042 shRNA (m) Lentiviral Particles
sc-150235-V 200 µL

Olfr1042 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Human PKBG (Protein Kinase B Gamma) ValidElisa Kit
EK340594 96 Well

Human PKBG (Protein Kinase B Gamma) ValidElisa Kit

Sign In for Pricing
View Details
Lefty (D-6) Alexa Fluor® 790
sc-365845 AF790 200 µg/mL

Lefty (D-6) Alexa Fluor® 790

Sign In for Pricing
View Details
CCDC75 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15305126 3x 1.0µg DNA

CCDC75 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Guinea pig Surfactant Associated Protein D (SPD) ELISA Kit
NSL0232Gp 96 Tests

Guinea pig Surfactant Associated Protein D (SPD) ELISA Kit

Sign In for Pricing
View Details
alpha TubµLin (TUBA1A) Human shRNA Plasmid Kit (Locus ID 7846)
TL315582 1 Kit

alpha TubµLin (TUBA1A) Human shRNA Plasmid Kit (Locus ID 7846)

Sign In for Pricing
View Details