Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB9 Rabbit Polyclonal Antibody (FITC)

ABCB9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TAPL, EST122234

UniProt

Q9NP78

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCB9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R13L Blocking peptide
orb1441932 500 µg

PPP1R13L Blocking peptide

Sign In for Pricing
View Details
Tropomodulin 2 (TMOD2) Human Over-expression Lysate
orb1340492 100 µg

Tropomodulin 2 (TMOD2) Human Over-expression Lysate

Sign In for Pricing
View Details
HMGN3 Protein Vector (Rat) (pPB-N-His)
PV273019 500 ng

HMGN3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
RAB4A (RAB4A, Member RAS Oncogene Family, HRES-1/RAB4, RAB4) (MaxLight 405) discontinued
250808-ML405 100 µL

RAB4A (RAB4A, Member RAS Oncogene Family, HRES-1/RAB4, RAB4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RAB6B (RAB6B, Member RAS Oncogene Family) (MaxLight 405) discontinued
250809-ML405 100 µL

RAB6B (RAB6B, Member RAS Oncogene Family) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral human POLR3F shRNA (UAS) - Lentiviral human POLR3F shRNA (UAS, iRFP) plasmid
GTR15311995 1 Vial

Lentiviral human POLR3F shRNA (UAS) - Lentiviral human POLR3F shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details