Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB9 Rabbit Polyclonal Antibody (HRP)

ABCB9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAPL, EST122234

UniProt

Q9NP78

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCB9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ras-related protein Rab-20 (RAB20) ELISA Kit
abx541094 96 Tests

Human Ras-related protein Rab-20 (RAB20) ELISA Kit

Sign In for Pricing
View Details
MESP1 Rabbit pAb
E47R9471 100 µL

MESP1 Rabbit pAb

Sign In for Pricing
View Details
RPL27 Rabbit Polyclonal Antibody (Fluoro647)
orb3097067 100 µg

RPL27 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
EGFL7 sgRNA CRISPR Lentivector (Human) (Target 3)
K0661904 1.0 µg DNA

EGFL7 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 4 (IL4)
TRV-0058708-01 20 µL

Polyclonal Antibody to Interleukin 4 (IL4)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 4 (IL4)
TRV-0058708-02 100 µL

Polyclonal Antibody to Interleukin 4 (IL4)

Sign In for Pricing
View Details