Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB1 Rabbit Polyclonal Antibody (HRP)

SNTB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A1B, SNT2, BSYN2, 59-DAP, DAPA1B, SNT2B1, TIP-43

UniProt

Q13884

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNTB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066301

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4EBP1 antibody
70R-33533 0.1 mg

4EBP1 antibody

Sign In for Pricing
View Details
3-Chloro-2-hydroxypropyltrimethyl Ammonium Chloride (60% in Water)
424851-01 1 g

3-Chloro-2-hydroxypropyltrimethyl Ammonium Chloride (60% in Water)

Sign In for Pricing
View Details
3-Chloro-2-hydroxypropyltrimethyl Ammonium Chloride (60% in Water)
424851-02 10 g

3-Chloro-2-hydroxypropyltrimethyl Ammonium Chloride (60% in Water)

Sign In for Pricing
View Details
CWH43 (NM_025087) Human Over-expression Lysate
LC410909 20 µg

CWH43 (NM_025087) Human Over-expression Lysate

Sign In for Pricing
View Details
SCN3A Rabbit Polyclonal Antibody (BF594)
orb2537512 100 µL

SCN3A Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Bordetella supplement
81013 10 Vials

Bordetella supplement

Sign In for Pricing
View Details