Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcc12 Rabbit Polyclonal Antibody (FITC)

Abcc12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MR, MRP9, 4930467B22Rik

UniProt

Q80WJ6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)
orb2907827-01 20 µg

Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)
orb2907827-02 100 µg

Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)

Sign In for Pricing
View Details
SDF2 Protein, Human, Recombinant (His Tag)
PH50038I2 100 µg

SDF2 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum murI Protein (aa 1-257) (strain ATCC 19397 / Type A)
VAng-Lsx8342-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum murI Protein (aa 1-257) (strain ATCC 19397 / Type A)

Sign In for Pricing
View Details
DMEM with L-alanyl-L-glutamine, HEPES (No Glucose)
abx704911 500 mL

DMEM with L-alanyl-L-glutamine, HEPES (No Glucose)

Sign In for Pricing
View Details
ADRA2C Rabbit Polyclonal Antibody (Cy3)
orb984101 100 µL

ADRA2C Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details