Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcc12 Rabbit Polyclonal Antibody (HRP)

Abcc12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MR, MRP9, 4930467B22Rik

UniProt

Q80WJ6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Screw Caps with O-ring, Violet
SC-V 500 per Unit, 8 Units per Case

Screw Caps with O-ring, Violet

Sign In for Pricing
View Details
Canine CD68 Recombinant Protein (N-His)
CW657012-01 50 µg

Canine CD68 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Canine CD68 Recombinant Protein (N-His)
CW657012-02 100 µg

Canine CD68 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Canine CD68 Recombinant Protein (N-His)
CW657012-03 1 mg

Canine CD68 Recombinant Protein (N-His)

Sign In for Pricing
View Details
RPS26P43 ORF Vector (Human) (pORF)
ORF031459 1.0 µg DNA

RPS26P43 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DGKH Rabbit Polyclonal Antibody (BF594)
orb2438228 100 µL

DGKH Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details