Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcc12 Rabbit Polyclonal Antibody (HRP)

Abcc12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MR, MRP9, 4930467B22Rik

UniProt

Q80WJ6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UFD1L sgRNA CRISPR Lentivector (Human) (Target 3)
K2582204 1.0 µg DNA

UFD1L sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Human MICA Antibody (SAA1688)
HS894023-01 50 µg

Anti-Human MICA Antibody (SAA1688)

Sign In for Pricing
View Details
Anti-Human MICA Antibody (SAA1688)
HS894023-02 100 µg

Anti-Human MICA Antibody (SAA1688)

Sign In for Pricing
View Details
Anti-Human MICA Antibody (SAA1688)
HS894023-03 1 mg

Anti-Human MICA Antibody (SAA1688)

Sign In for Pricing
View Details
Lentiviral mouse Hmgxb4 shRNA (UAS) - Lentiviral mouse Hmgxb4 shRNA (UAS, GFP) plasmid
GTR15268930 1 Vial

Lentiviral mouse Hmgxb4 shRNA (UAS) - Lentiviral mouse Hmgxb4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mast Cell Tryptase (AA1) FITC
sc-59587 FITC 200 µg/mL

Mast Cell Tryptase (AA1) FITC

Sign In for Pricing
View Details