Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCA10 Rabbit Polyclonal Antibody (HRP)

ABCA10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EST698739

UniProt

Q8WWZ4

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence WSKHQNTHHEIFENEINPEHSSDDSFEPVSPEFHGKEAIRIRNVIKEYNG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WSKHQNTHHEIFENEINPEHSSDDSFEPVSPEFHGKEAIRIRNVIKEYNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

176 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

NCBI Accession Number

NP_525021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVB12A Rabbit pAb
orb2712998-01 50 µL

MVB12A Rabbit pAb

Sign In for Pricing
View Details
MVB12A Rabbit pAb
orb2712998-02 100 µL

MVB12A Rabbit pAb

Sign In for Pricing
View Details
Rat Rufy2 Pre-designed siRNA Set B
SI212319B 1 Each

Rat Rufy2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
M-Dinitrobenzene 98% For Synthesis
01056 00500 500 g

M-Dinitrobenzene 98% For Synthesis

Sign In for Pricing
View Details
S100A4 Protein, Mouse, Recombinant
MBS8122775-01 0.1 mg

S100A4 Protein, Mouse, Recombinant

Sign In for Pricing
View Details
S100A4 Protein, Mouse, Recombinant
MBS8122775-02 5x 0.1 mg

S100A4 Protein, Mouse, Recombinant

Sign In for Pricing
View Details