Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc10a2 Rabbit Polyclonal Antibody (Biotin)

Slc10a2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AS, ASBT, IBAT, ISBT, AI605518, 9130221J18Rik

UniProt

P70172

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-01 48 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-02 96 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-03 5x 96 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-04 10x 96 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
MultiSUB Maxi with 20 x 25cm Gel tray
MSMAXI25 1 Each

MultiSUB Maxi with 20 x 25cm Gel tray

Sign In for Pricing
View Details
Human Opticin (OPTC) ELISA Kit
TRV-0002447 96 Well Plate

Human Opticin (OPTC) ELISA Kit

Sign In for Pricing
View Details