Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc10a2 Rabbit Polyclonal Antibody (Biotin)

Slc10a2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AS, ASBT, IBAT, ISBT, AI605518, 9130221J18Rik

UniProt

P70172

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit
MBS2500537-01 24 Tests

Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit
MBS2500537-02 48 Tests

Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit
MBS2500537-03 96 Tests

Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit
MBS2500537-04 5x 96 Tests

Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit
MBS2500537-05 10x 96 Tests

Guinea pig SGK2 (Serum/Glucocorticoid Regulated Kinase 2) ELISA Kit

Sign In for Pricing
View Details
Anti-ARG2 Antibody Picoband®, FITC Conjugate
A02244-FITC 100 µg/Vial

Anti-ARG2 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details