Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc10a2 Rabbit Polyclonal Antibody (FITC)

Slc10a2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AS, ASBT, IBAT, ISBT, AI605518, 9130221J18Rik

UniProt

P70172

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF14, ID (TNFSF14, HVEML, LIGHT, Tumor necrosis factor ligand superfamily member 14, Herpes virus entry mediator ligand, CD258, Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form) (MaxLight 650) discontinued
043084-ML650 100 µL

TNFSF14, ID (TNFSF14, HVEML, LIGHT, Tumor necrosis factor ligand superfamily member 14, Herpes virus entry mediator ligand, CD258, Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CCDC103 Over-expression Lysate Product
GWB-9A345C 0.1 mg

CCDC103 Over-expression Lysate Product

Sign In for Pricing
View Details
TFB1M Polyclonal Antibody
orb616532-01 50 μL

TFB1M Polyclonal Antibody

Sign In for Pricing
View Details
TFB1M Polyclonal Antibody
orb616532-02 100 µL

TFB1M Polyclonal Antibody

Sign In for Pricing
View Details
MAGOHP CRISPRa sgRNA lentivector (set of three targets)(Human)
61535121 3x 1.0µg DNA

MAGOHP CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rabbit Monoclonal SOD2/Mn-SOD [ac Lys68] Antibody (23G5)
NBP3-26531-50ul 50 µL

Rabbit Monoclonal SOD2/Mn-SOD [ac Lys68] Antibody (23G5)

Sign In for Pricing
View Details