Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A5 Rabbit Polyclonal Antibody (FITC)

SLC5A5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NIS, TDH1

UniProt

Q92911

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000444

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLPH3, NT (Golgi Phosphoprotein 3, Coat Protein GPP34, FLJ90675, GPP34, GOPP1, Mitochondrial DNA Absence Factor, MIDAS) (Biotin)
MBS6478706-01 0.2 mL

GOLPH3, NT (Golgi Phosphoprotein 3, Coat Protein GPP34, FLJ90675, GPP34, GOPP1, Mitochondrial DNA Absence Factor, MIDAS) (Biotin)

Sign In for Pricing
View Details
GOLPH3, NT (Golgi Phosphoprotein 3, Coat Protein GPP34, FLJ90675, GPP34, GOPP1, Mitochondrial DNA Absence Factor, MIDAS) (Biotin)
MBS6478706-02 5x 0.2 mL

GOLPH3, NT (Golgi Phosphoprotein 3, Coat Protein GPP34, FLJ90675, GPP34, GOPP1, Mitochondrial DNA Absence Factor, MIDAS) (Biotin)

Sign In for Pricing
View Details
Human MRPL43 Pre-designed siRNA Set A
SI009841A 1 Each

Human MRPL43 Pre-designed siRNA Set A

Sign In for Pricing
View Details
KCNH3 Rabbit Polyclonal Antibody (BF555)
orb2495607 100 µL

KCNH3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
MASP2 (Mannan-Binding Lectin Serine Protease 2, MBL-Associated Serine Protease 2, Mannose-Binding Protein-Associated Serine Protease 2, MASP-2) discontinued
344256-01 100 µL

MASP2 (Mannan-Binding Lectin Serine Protease 2, MBL-Associated Serine Protease 2, Mannose-Binding Protein-Associated Serine Protease 2, MASP-2) discontinued

Sign In for Pricing
View Details
MASP2 (Mannan-Binding Lectin Serine Protease 2, MBL-Associated Serine Protease 2, Mannose-Binding Protein-Associated Serine Protease 2, MASP-2) discontinued
344256-02 200 µL

MASP2 (Mannan-Binding Lectin Serine Protease 2, MBL-Associated Serine Protease 2, Mannose-Binding Protein-Associated Serine Protease 2, MASP-2) discontinued

Sign In for Pricing
View Details