Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC11A1 Rabbit Polyclonal Antibody (Biotin)

SLC11A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LSH, NRAMP, NRAMP1

UniProt

P49279

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC11A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)
SIPG055Hu01-01 10 µg

Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)

Sign In for Pricing
View Details
Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)
SIPG055Hu01-02 50 µg

Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)

Sign In for Pricing
View Details
Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)
SIPG055Hu01-03 200 µg

Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)

Sign In for Pricing
View Details
Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)
SIPG055Hu01-04 1 mg

Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)

Sign In for Pricing
View Details
Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)
SIPG055Hu01-05 5 mg

Recombinant Purinergic Receptor P2Y, G Protein Coupled 14 (P2RY14)

Sign In for Pricing
View Details
Phosphodiesterase 5A (Phosphodiesterase 5A cGMP-specific, PDE5A, PDE-5A, PDE5A1, cGMP Binding cGMP Specific 3' 5' Cyclic Nucleotide Phosphodiesterase, cGMP-binding cGMP-specific 3’ 5’-cyclic Nucleotide Phosphodiesterase, cGMP Binding cGMP Specific Phosphodiesterase, cGMP Binding/cGMP Specific Phosphodiesterase, CGBPDE, CGB-PDE, cGMP Specific 3'5' Cyclic Phosphodiesterase, CN5A, CN5N, PDE5, PDE-5)
P4072-05F 100 µg

Phosphodiesterase 5A (Phosphodiesterase 5A cGMP-specific, PDE5A, PDE-5A, PDE5A1, cGMP Binding cGMP Specific 3' 5' Cyclic Nucleotide Phosphodiesterase, cGMP-binding cGMP-specific 3’ 5’-cyclic Nucleotide Phosphodiesterase, cGMP Binding cGMP Specific Phosphodiesterase, cGMP Binding/cGMP Specific Phosphodiesterase, CGBPDE, CGB-PDE, cGMP Specific 3'5' Cyclic Phosphodiesterase, CN5A, CN5N, PDE5, PDE-5)

Sign In for Pricing
View Details