Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC41A3 Rabbit Polyclonal Antibody (Biotin)

SLC41A3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SLC41A1-L2

UniProt

Q96GZ6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC41A3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL1 Rabbit Polyclonal Antibody
TA314898 100 µL

TCEAL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tyrosine Hydroxylase Rabbit mAb Antibody
orb1951639-01 50 µL

Tyrosine Hydroxylase Rabbit mAb Antibody

Sign In for Pricing
View Details
Tyrosine Hydroxylase Rabbit mAb Antibody
orb1951639-02 100 µL

Tyrosine Hydroxylase Rabbit mAb Antibody

Sign In for Pricing
View Details
CYFIP1 Antibody - C-terminal region : Biotin (ARP64537_P050-Biotin)
ARP64537_P050-Biotin 100 µL

CYFIP1 Antibody - C-terminal region : Biotin (ARP64537_P050-Biotin)

Sign In for Pricing
View Details
KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 650)
128966-ML650 100 µL

KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 650)

Sign In for Pricing
View Details
NSC2805 5mg
A24255-5 5 mg

NSC2805 5mg

Sign In for Pricing
View Details