Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC10A5 Rabbit Polyclonal Antibody (HRP)

SLC10A5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P5

UniProt

Q5PT55

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC10A5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001010893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf80 (ANGPTL8) (NM_018687) Human Tagged ORF Clone Lentiviral Particle
RC218000L2V 200 µL

C19orf80 (ANGPTL8) (NM_018687) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039295-01 0.1 mL

PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039295-02 0.2 mL

PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039295-03 0.5 mL

PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039295-04 1 mL

PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039295-05 5 mL

PE-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details