Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A9 Rabbit Polyclonal Antibody (HRP)

SLC5A9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGLT4

UniProt

Q2M3M2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001011547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse IL-8 ELISA Kit
orb565045-01 48 Tests

Horse IL-8 ELISA Kit

Sign In for Pricing
View Details
Horse IL-8 ELISA Kit
orb565045-02 96 Tests

Horse IL-8 ELISA Kit

Sign In for Pricing
View Details
24,24-Dimethyl-5α-lanosta-9 (11),25-dien-3β-ol
orb1680604 5 mg

24,24-Dimethyl-5α-lanosta-9 (11),25-dien-3β-ol

Sign In for Pricing
View Details
Human Skeletal Muscle Cell Medium
ARM0160 500 mL

Human Skeletal Muscle Cell Medium

Sign In for Pricing
View Details
NAPG, ID (NAPG, SNAPG, Gamma-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein gamma) (MaxLight 650)
MBS6323800-01 0.1 mL

NAPG, ID (NAPG, SNAPG, Gamma-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein gamma) (MaxLight 650)

Sign In for Pricing
View Details
NAPG, ID (NAPG, SNAPG, Gamma-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein gamma) (MaxLight 650)
MBS6323800-02 5x 0.1 mL

NAPG, ID (NAPG, SNAPG, Gamma-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein gamma) (MaxLight 650)

Sign In for Pricing
View Details