Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC10A7 Rabbit Polyclonal Antibody (HRP)

SLC10A7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P7, SSASKS, C4orf13

UniProt

Q0GE19

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC10A7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ARF6 Polyclonal Antibody
MBS9008691 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ARF6 Polyclonal Antibody

Sign In for Pricing
View Details
VOM1R51 Adenovirus (Rat)
50039056 1.0 mL

VOM1R51 Adenovirus (Rat)

Sign In for Pricing
View Details
N-Ethyl-N- (2-hydroxyethyl) -p-phenylenediamine sulfate salt
sc-228706 25 g

N-Ethyl-N- (2-hydroxyethyl) -p-phenylenediamine sulfate salt

Sign In for Pricing
View Details
MOV10 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62117R-PerCP-Cy5.5 100 µL

MOV10 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Duck N-Acetylneuraminic Acid Synthase ELISA Kit
MBS076002 Inquire

Duck N-Acetylneuraminic Acid Synthase ELISA Kit

Sign In for Pricing
View Details
PPAR Gamma Polyclonal Antibody, FITC Conjugated
bs-4590R-FITC-TR 20 µL

PPAR Gamma Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details